Alignment of ASP3-1/YLR155C and PDB 1WLS (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1WLS (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 292 aa (80.4%)P-value = 1.1e-18%Identity = 27%Similar = 19
Alignment Position

Sequence Alignment

ASP3-1

35

IKIFGTGGTIAS-KGSTSATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLN

93






I I G GGTIAS KG GY L+V+ +++ + ++ +A ++ + NV S +


1WLS_(A)

3

ILILGXGGTIASVKGER-----GYESALSVSKILK-LAGISSEAKIEARDLXNVDSTLIQ

56

ASP3-1

94

YTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIAGAMRPAT

152






+ L I + + +Y G V+THGTDT +A L + N P+ + G+ P T


1WLS_(A)

57

PSDWERLAKEIEKEVW--EYDGIVITHGTDTXAYSASXLSFXLRNPPIPIVLTGSXLPIT

114

ASP3-1

153

ATSADGPMNLYQAVSIAASEKSLG-RGTMITLNDRIASGFWTTKMNANSLDTFRADEQGY

211






++D P NL A+ LG RG I N ++ G +K+ + D F +


1WLS_(A)

115

EKNSDAPFNLRTALEFV----KLGIRGIYIAFNGKVXLGVRASKIRSXGFDAFESINYPN

170

ASP3-1

212

LGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLG

271






+ +D + + P F+ +D P+V+++ GL+ +++ +A++ LG


1WLS_(A)

171

VAEIKDDKLRILHIP------DFYGDEFFSDIKYEPKVLVIKLIPGLSGDIVREALR-LG

223

ASP3-1

272

AKGIVLAGSGAGSWTATGSIVNEQLYE-EYGIPIVHSRRTA-DGTVPPDDAPEYAIG

326






KGI+L G G G G+ + E + IP+V + + DG D Y +G


1WLS_(A)

224

YKGIILEGYGVGGIPYRGTDLFEVVSSISKRIPVVLTTQAIYDGV----DLQRYKVG

276

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1WLS (Chain A)
Crystal Structure Of L-Asparaginase I Homologue Protein From Pyrococcus Horikoshii
  • PDB_Info
  • Homolog SourcePyrococcus horikoshii
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05