Alignment of ASP3-1/YLR155C and PDB 1O7J (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1O7J (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 312 aa (86%)P-value = 5.9e-62%Identity = 46%Similar = 15
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






LP+I I TGGTIA +T T GY G L V+ LI AVP + + AN+ Q SN+ S


1O7J_(A)

4

LPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTLINAVPEVKKLANVKGEQFSNMASE

63

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






++ ++ L ++E LA DD G V+THGTDT+EE+A+FL LT+ S+KPV AMRP


1O7J_(A)

64

NMTGDVVLKLSQRVNELLARDDVDGVVITHGTDTVEESAYFLHLTVKSDKPVVFVAAMRP

123

ASP3-1

151

ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQG

210






ATA SADGPMNL +AV +A ++S GRG M+ +NDRI S + TK NA++LDTFRA+E+G


1O7J_(A)

124

ATAISADGPMNLLEAVRVAGDKQSRGRGVMVVINDRIGSARYITKTNASTLDTFRANEEG

183

ASP3-1

211

YLGYFSNDDVEFYYPPVKPNGWQ-FFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKD

269






YLG + + + K + + FD+ LT +P+V ILY YQ +PE + A


1O7J_(A)

184

YLGVIIGNRIYYQNRIDKLHTTRSVFDVRGLTS---LPKVDILYGYQD-DPEYLYDAAIQ

239

ASP3-1

270

LGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTVPPDDAPEYAIGSGY

329






G KGIV AG GAGS + G I + E G+ ++ S RT +G VPPD+ + S


1O7J_(A)

240

HGVKGIVYAGMGAGSVSVRG-IAGMRKALEKGVVVMRSTRTGNGIVPPDEELPGLV-SDS

297

ASP3-1

330

LNPQKSRILLQLCL

343






LNP +RILL L L


1O7J_(A)

298

LNPAHARILLMLAL

311

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1O7J (Chain A)
Atomic Resolution Structure Of Erwinia Chrysanthemi L-Asparaginase
  • PDB_Info
  • Homolog SourceDickeya chrysanthemi
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05