Alignment of ASP3-1/YLR155C and PDB 1JJA (chain F) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1JJA (chain F)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 326 aa (89.8%)P-value = 8.5e-54%Identity = 41%Similar = 16
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






LP+I I TGGTIA G SAT + Y+VG + V +L+ AVP L + AN+ QV N+GS


1JJA_(F)

1

LPNITILATGGTIAG-GGDSATKSNYTVGKVGVENLVNAVPQLKDIANVKGEQVVNIGSQ

59

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






+N + L I+ D G V+THGT+TMEETA+FLDLT+ +KPV + GAMRP


1JJA_(F)

60

DMNDNVWLTLAKKINTDCDKTD--GFVITHGTETMEETAYFLDLTVKCDKPVVMVGAMRP

117

ASP3-1

151

ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQG

210






+T+ SADGP NLY AV AA + S RG ++ +ND + G TK N + TF++ G


1JJA_(F)

118

STSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYG

177

ASP3-1

211

YLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKD

269






LGY N +++ P + + FD+S L +E+P+V I+Y+Y + +L KA+ D


1JJA_(F)

178

PLGYIHNGKIDYQRTPARKHTSDTPFDVSKL---NELPKVGIVYNYANAS-DLPAKALVD

233

ASP3-1

270

LGAKGIVLAGSGAGSWTATGSIVNE-QLYEEYGIPIVHSRRTADGTVPPD---DAPEYA-

324






G GIV AG G G+ S+ + + G +V S R G D D +Y


1JJA_(F)

234

AGYDGIVSAGVGNGNLYK--SVFDTLATAAKTGTAVVRSSRVPTGATTQDAEVDDAKYGF

291

ASP3-1

325

IGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFS

357






+ SG LNPQK+R+LLQL L QI+ +F+


1JJA_(F)

292

VASGTLNPQKARVLLQLALTQTKDPQQIQQIFN

324

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1JJA (Chain F)
Crystal Structure Of Orthorhombic Form Of D90e Mutant Of Escherichia Coli L-Asparaginase Ii
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05