Alignment of ASP3-1/YLR155C and PDB 1IHD (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1IHD (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 326 aa (89.8%)P-value = 8.5e-54%Identity = 41%Similar = 16
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






LP+I I TGGTIA G SAT + Y+VG + V +L+ AVP L + AN+ QV N+GS


1IHD_(A)

1

LPNITILATGGTIAG-GGDSATKSNYTVGKVGVENLVNAVPQLKDIANVKGEQVVNIGSQ

59

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






+N + L I+ D G V+THGT+TMEETA+FLDLT+ +KPV + GAMRP


1IHD_(A)

60

DMNDNVWLTLAKKINTDCDKTD--GFVITHGTETMEETAYFLDLTVKCDKPVVMVGAMRP

117

ASP3-1

151

ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQG

210






+T+ SADGP NLY AV AA + S RG ++ +ND + G TK N + TF++ G


1IHD_(A)

118

STSMSADGPFNLYNAVVTAADKASANRGVLVVMNDTVLDGRDVTKTNTTDVATFKSVNYG

177

ASP3-1

211

YLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKD

269






LGY N +++ P + + FD+S L +E+P+V I+Y+Y + +L KA+ D


1IHD_(A)

178

PLGYIHNGKIDYQRTPARKHTSDTPFDVSKL---NELPKVGIVYNYANAS-DLPAKALVD

233

ASP3-1

270

LGAKGIVLAGSGAGSWTATGSIVNE-QLYEEYGIPIVHSRRTADGTVPPD---DAPEYA-

324






G GIV AG G G+ S+ + + G +V S R G D D +Y


1IHD_(A)

234

AGYDGIVSAGVGNGNLYK--SVFDTLATAAKTGTAVVRSSRVPTGATTQDAEVDDAKYGF

291

ASP3-1

325

IGSGYLNPQKSRILLQLCLYSGYGMDQIRSVFS

357






+ SG LNPQK+R+LLQL L QI+ +F+


1IHD_(A)

292

VASGTLNPQKARVLLQLALTQTKDPQQIQQIFN

324

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1IHD (Chain A)
Crystal Structure Of Trigonal Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05