Take our Survey

Alignment of ASP3-1/YLR155C and PDB 1HG0 (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1HG0 (chain D)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 312 aa (86%)P-value = 5.5e-62%Identity = 46%Similar = 15
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






LP+I I TGGTIA +T T GY G L V+ LI AVP + + AN+ Q SN+ S


1HG0_(D)

4

LPNIVILATGGTIAGSAATGTQTTGYKAGALGVDTLINAVPEVKKLANVKGEQFSNMASE

63

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






++ ++ L ++E