Alignment of ASP3-1/YLR155C and PDB 1DJP (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1DJP (chain B)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 325 aa (89.5%)P-value = 2.8e-44%Identity = 35%Similar = 20
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






L ++ I TGGTIA G+++A +A Y + V+ LI VP LA+ AN+ QV + S


1DJP_(B)

2

LANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASE

61

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






S+ L+ L ++E S+D G V+THGTDT+EETA+FL+L ++KP+ + G+MRP


1DJP_(B)

62

SITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVVGSMRP

121

ASP3-1

151

ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQG

210






TA SADG +NLY AV++A+++ S G+G ++T+ND I SG +K + F++ G


1DJP_(B)

122

GTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKS-AWG

180

ASP3-1

211

YLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKD

269






LG ++ P K + FDI + S +P+V I YSY + + KA+


1DJP_(B)

181

PLGMVVEGKSYWFRLPAKRHTVNSEFDIKQI---SSLPQVDIAYSYGNVT-DTAYKALAQ

236

ASP3-1

270

LGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADG------TVPPDDAPEY

323






GAK ++ AG+G GS ++ +QL + G I+ S G PDD ++


1DJP_(B)

237

NGAKALIHAGTGNGSVSSRVVPALQQLRKN-GTQIIRSSHVNQGGFVLRNAEQPDDKNDW

295

ASP3-1

324

AIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVF

356






+ LNP+K+RIL + + +++ +F


1DJP_(B)

296

VVAHD-LNPEKARILAMVAMTKTQDSKELQRIF

327

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1DJP (Chain B)
Crystal Structure Of Pseudomonas 7a Glutaminase-Asparaginase With The Inhibitor Don Covalently Bound In The Active Site
  • PDB_Info
  • Homolog SourcePseudomonas sp. 7A
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05