Alignment of ASP3-1/YLR155C and PDB 1AGX (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1AGX (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 323 aa (89%)P-value = 4.9e-45%Identity = 36%Similar = 21
Alignment Position

Sequence Alignment

ASP3-1

34

SIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSNSL

92






++ I TGGTIA G++S +A YS + V+ LI+AVP + + AN+ +Q V S S+


1AGX_(A)

3

NVVIVATGGTIAGAGASSTNSATYSAAKVPVDALIKAVPQVNDLANITGIQALQVASESI

62

ASP3-1

93

NYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRPAT

152






L+ L +++ + G V+THGTDTMEETAFFL+L ++++KP+ + G+MRP+T


1AGX_(A)

63

TDKELLSLARQVNDLVKKPSVNGVVITHGTDTMEETAFFLNLVVHTDKPIVLVGSMRPST

122

ASP3-1

153

ATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTK-MNANSLDTFRADEQGY

211






A SADGP+NLY AV++A+S ++ +G M+ +ND I + TK +N ++ F + G


1AGX_(A)

123

ALSADGPLNLYSAVALASSNEAKNKGVMVLMNDSIFAARDVTKGINIHT-HAF-VSQWGA

180

ASP3-1

212

LGYFSNDDVEFYYPPVKPN-GWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDL

270






LG ++ VK + F+I + + +P V I+Y + P+ +A


1AGX_(A)

181

LGTLVEGKPYWFRSSVKKHTNNSEFNIEKIQGDA-LPGVQIVYGSDNMMPDAY-QAFAKA

238

ASP3-1

271

GAKGIVLAGSGAGSWTATGSIVNE--QLYEEYGIPIVHSRRTADGTV-----PPDDAPEY

323






G K I+ AG+G GS +V E +L++E G+ IV S R A G V PDD +Y


1AGX_(A)

239

GVKAIIHAGTGNGSMA--NYLVPEVRKLHDEQGLQIVRSSRVAQGFVLRNAEQPDD--KY

294

ASP3-1

324

A-IGSGYLNPQKSRILLQLCLYSGYGMDQIRSVF

356






I + LNPQK+R+L+ L L +I+++F


1AGX_(A)

295

GWIAAHDLNPQKARLLMALALTKTNDAKEIQNMF

328

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1AGX (Chain A)
Refined Crystal Structure Of Acinetobacter Glutaminasificans Glutaminase-Asparaginase
  • PDB_Info
  • Homolog SourceAcinetobacter glutaminasificans
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05