Take our Survey

Alignment of YLR035C-A and PDB 3S3N (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YLR035C-A. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YLR035C-A and PDB protein 3S3N (chain A)Jump to
Structure
Alignment Details
YLR035C-A length = 1156 aaAlignment Length = 201 aa (17.4%)P-value = 9.7e-06%Identity = 27%Similar = 16
Alignment Position

Sequence Alignment

YLR035C-A

36

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

95






+C CLI ++ G L+ +PF D GP+ P Y + D T


3S3N_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YLR035C-A

96

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

152






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3S3N_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YLR035C-A

153

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

212






GI ++T ++HG ER N + T+L G P W+ + + N+ S


3S3N_(A)

205

RGIHLEFSTPYHPQSHGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YLR035C-A

213

PKSKKSARQHAGLAGLDISTLLPF

236






P K + H L G+D +T PF


3S3N_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3N (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) S217h Mutant Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05