Alignment of YLR035C-A and PDB 3OYK (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YLR035C-A. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YLR035C-A and PDB protein 3OYK (chain B)Jump to
Structure
Alignment Details
YLR035C-A length = 1156 aaAlignment Length = 201 aa (17.4%)P-value = 9.9e-06%Identity = 27%Similar = 16
Alignment Position

Sequence Alignment

YLR035C-A

36

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

95






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYK_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YLR035C-A

96

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

152






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYK_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YLR035C-A

153

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

212






GI ++T ++HG ER N + T+L G P W+ + + N+ S


3OYK_(B)

205

RGIHLEFSTPYHPQSHGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YLR035C-A

213

PKSKKSARQHAGLAGLDISTLLPF

236






P K + H L G+D +T PF


3OYK_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYK (Chain B)
Crystal Structure Of The Pfv S217h Mutant Intasome Bound To Manganese
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05