Alignment of YLR035C-A and PDB 2X74 (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YLR035C-A. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YLR035C-A and PDB protein 2X74 (chain B)Jump to
Structure
Alignment Details
YLR035C-A length = 1156 aaAlignment Length = 184 aa (15.9%)P-value = 0.004198%Identity = 24%Similar = 16
Alignment Position

Sequence Alignment

YLR035C-A

53

GSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSIL

112






G L+ +PF D GP+ P Y + D T F W+YP + +


2X74_(B)

1

GPILRPDRPQKPFDKFFXDYIGPLP--PSQGYLYVLVVVDGXTGFTWLYPTKAPSTSATV

58

YLR035C-A

113

DVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAE

172






+ + A VI D+G+ +T+ T ++ ++ GI ++T ++ E


2X74_(B)

59

KSLNVLTSI------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVE

112

YLR035C-A

173

RLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDIST

232






R N T+L G P W+ + + N+ SP K + H L G+D +T


2X74_(B)

113

RKNSDX-KRLLTKLLV-GRPTK-WYDLLPVVQLAXNNTYSPVLKYTP--HQLLFGIDSNT

167

YLR035C-A

233

LLPF

236






PF


2X74_(B)

168

--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X74 (Chain B)
Human Foamy Virus Integrase - Catalytic Core.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05