Alignment of JLP1/YLL057C and PDB 1VZ5 (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein JLP1/YLL057C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene JLP1/YLL057C and PDB protein 1VZ5 (chain D)Jump to
Structure
Alignment Details
JLP1 length = 413 aaAlignment Length = 281 aa (68%)P-value = 4.8e-22%Identity = 31%Similar = 16
Alignment Position

Sequence Alignment

JLP1

112

QLKVKKITPKLGLEINGIQLTDLSDAAKDEL--ALLVAQKGVVVFRNQNFADEGPDYVTE

169






+L V + ++G EI G++L+ DAA E A LV K V+ FR Q D+ ++


1VZ5_(D)

14

ELDVHPVAGRIGAEIRGVKLSPDLDAATVEAIQAALVRHK-VIFFRGQTHLDDQ----SQ

68

JLP1

170

YGRHFGKLHIHQTSGHPQNNPELHITFRRPDAEEFARVFDDSTS--SGGWHTDVSY-ELQ

226






G F KL G P +P + + D + D + + WHTDV++ E


1VZ5_(D)

69

EG--FAKL-----LGEPVAHPTVPVV----DGTRYLLQLDGAQGQRANSWHTDVTFVEAY

117

JLP1

227

PPSYTFFSVVEGPDGGGDTLFADTIEAFDRLSKPLQDFLSTLHVIHSSKEQAENSQRQ--

284






P + SVV P GGDT++A+T A+ L +PL++ L +HS++ + +


1VZ5_(D)

118

PKASILRSVV-APASGGDTVWANTAAAYQELPEPLRELADKLWAVHSNEYDYASLKPDID

176

JLP1

285

-GGIKRRAPV-THI-----HPLVRVHPVLKKKCLYVNRAFSRKIVELKRQESESLLNFLY

337






++R V T HP+VRVHP+ ++ L + F ++I +S+ L L


1VZ5_(D)

177

PAKLERHRKVFTSTVYETEHPVVRVHPISGERALQLGH-FVKRIKGYSLADSQHLFAVLQ

235

JLP1

338

NLVESSHDLQLRAKWEPHSVVIWDNRRVQHSAVIDW-EEPIHRHAFRITPQAERPV

392






V + +R +WE V IWDNR QH AV D+ +P R R+T E PV


1VZ5_(D)

236

GHVTRLENT-VRWRWEAGDVAIWDNRATQHYAVDDYGTQP--RIVRRVTLAGEVPV

288

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1VZ5 (Chain D)
Succinate Complex Of Atsk
  • PDB_Info
  • Homolog SourcePseudomonas putida
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05