Take our Survey

Alignment of JLP1/YLL057C and PDB 1GY9 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein JLP1/YLL057C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene JLP1/YLL057C and PDB protein 1GY9 (chain A)Jump to
Structure
Alignment Details
JLP1 length = 413 aaAlignment Length = 280 aa (67.8%)P-value = 2.3e-33%Identity = 32%Similar = 19
Alignment Position

Sequence Alignment

JLP1

112

QLKVKKITPKLGLEINGIQLT-DLSDAAKDELALLVAQKGVVVFRNQNFADEGPDYVTEY

170






+L + + P +G +I+G LT LSD ++L V + VV R+Q P


1GY9_(A)

4

RLSITPLGPYIGAQISGADLTRPLSDNQFEQLYHAVLRHQVVFLRDQAIT---PQQQRAL

60

JLP1

171

GRHFGKLHIHQTSGHPQNNPELHITFRRPDAEEFARVFDDSTSSGGWHTDVSYELQPPSY

230






+ FG+LHIH H + E+ + D D+ + WHTDV++ PP+


1GY9_(A)

61

AQRFGELHIHPVYPHAEGVDEIIVL----DTHN-----DNPPDNDNWHTDVTFIETPPAG

111

JLP1

231

TFFSVVEGPDGGGDTLFADTIEAFDRLSKPLQDFLSTLHVIHS----------SKEQAEN

280






+ E P GGDTL+ I A++ LS P + LS L H K + E+


1GY9_(A)

112

AILAAKELPSTGGDTLWTSGIAAYEALSVPFRQLLSGLRAEHDFRKSFPEYKYRKTEEEH

171

JLP1

281

SQRQGGIKRRAPVTHIHPLVRVHPVLKKKCLYVNRAFSRKIVELKRQESESLLNFLYNLV

340






+ + + + P+ +HP+VR HPV K+ L+VN F+ +IV++ +ESE+LL+FL+ +


1GY9_(A)

172

QRWREAVAKNPPL--LHPVVRTHPVSGKQALFVNEGFTTRIVDVSEKESEALLSFLFAHI

229

JLP1

341

ESSHDLQLRAKWEPHSVVIWDNRRVQHSAVIDWEEPIHRHAFRITPQAERP

391






+ + Q+R +W+P+ + IWDNR QH A D+ P R R T ++P


1GY9_(A)

230

-TKPEFQVRWRWQPNDIAIWDNRVTQHYANADYL-PQRRIMHRATILGDKP

278

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1GY9 (Chain A)
TaurineALPHA-Ketoglutarate Dioxygenase From Escherichia Coli
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05