Alignment of SOD1/YJR104C and PDB 3KH3 (chain F) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein SOD1/YJR104C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene SOD1/YJR104C and PDB protein 3KH3 (chain F)Jump to
Structure
Alignment Details
SOD1 length = 155 aaAlignment Length = 150 aa (96.8%)P-value = 9.7e-42%Identity = 56%Similar = 12
Alignment Position

Sequence Alignment

SOD1

3

QAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVSAG

62






+AV VLKGD V G++ FEQ + P V I G + GFH+HEFGD T GC SAG


3KH3_(F)

3

KAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLH-GFHVHEFGDNTAGCTSAG

61

SOD1

63

PHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVIHA

122






PHFNP + HG P DE RHVGD+GNV D++GVA S +DS+I L G ++GR++V+H


3KH3_(F)

62

PHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHE

121

SOD1

123

GQDDLGKGDTEESLKTGNAGPRPACGVIGL

152






DDLGKG EES KTGNAG R ACGVIG+


3KH3_(F)

122

KADDLGKGGNEESTKTGNAGSRLACGVIGI

151

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3KH3 (Chain F)
Crystal Structure Of Human CuZN SUPEROXIDE DISMUTASE RECOMBINANTLY Produced In Leishmania Tarantolae; P212121 Crystal Form Containing 12 Chains In The Asymmetric Unit
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05