Alignment of YJL113W and PDB 4E7L (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YJL113W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YJL113W and PDB protein 4E7L (chain A)Jump to
Structure
Alignment Details
YJL113W length = 1549 aaAlignment Length = 200 aa (12.9%)P-value = 0.000230%Identity = 26%Similar = 22
Alignment Position

Sequence Alignment

YJL113W

279

DDSKINAIKPTSSPGFKL-----NKRSITLEDAHKRMGHTGIQQIENSIKHNHYEESL--

331






+D K+ +P G K+ +++ I L+ AH + HTG + I + ++ ++


4E7L_(A)

36

EDGKVKVSRPE---GVKIIPPQSDRQKIVLQ-AHN-LAHTGREATLLKIANLYWWPNMRK

90

YJL113W

332

DLIKEPNEFWCQTCKISKATKRNHYTGSMNNHSTDHEPGSSWCMDIFGPVSSSNADTKRY

391






D++K+ CQ C I+ A+ N +G + +P + +D GP+ S Y


4E7L_(A)

91

DVVKQLGR--CQQCLITNAS--NKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYL--Y

144

YJL113W

392

MLIMVDNNTRYCMTSTHFNKNAETILAQVRKNIQYVETQFDRKVREINSDRGTEFTNDQI

451






+L++VD T + + A + A V K++ + + KV I+SD+G FT+


4E7L_(A)

145

VLVVVDGMTGFTWL---YPTKAPSTSATV-KSLNVLTSIAIPKV--IHSDQGAAFTSSTF

198

YJL113W

452

EEYFISKGIHHILTSTQDHA-ANGRAER

478






E+ +GIH + ST H ++G+ ER


4E7L_(A)

199

AEWAKERGIH-LEFSTPYHPQSSGKVER

225

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4E7L (Chain A)
Pfv Integrase Strand Transfer Complex (Stc-Mn) Following Reaction In Crystallo, At 3.0 A Resolution.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05