Alignment of YJL113W and PDB 3S3M (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YJL113W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YJL113W and PDB protein 3S3M (chain A)Jump to
Structure
Alignment Details
YJL113W length = 1549 aaAlignment Length = 200 aa (12.9%)P-value = 0.000219%Identity = 26%Similar = 22
Alignment Position

Sequence Alignment

YJL113W

279

DDSKINAIKPTSSPGFKL-----NKRSITLEDAHKRMGHTGIQQIENSIKHNHYEESL--

331






+D K+ +P G K+ +++ I L+ AH + HTG + I + ++ ++


3S3M_(A)

36

EDGKVKVSRPE---GVKIIPPQSDRQKIVLQ-AHN-LAHTGREATLLKIANLYWWPNMRK

90

YJL113W

332

DLIKEPNEFWCQTCKISKATKRNHYTGSMNNHSTDHEPGSSWCMDIFGPVSSSNADTKRY

391






D++K+ CQ C I+ A+ N +G + +P + +D GP+ S Y


3S3M_(A)

91

DVVKQLGR--CQQCLITNAS--NKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYL--Y

144

YJL113W

392

MLIMVDNNTRYCMTSTHFNKNAETILAQVRKNIQYVETQFDRKVREINSDRGTEFTNDQI

451






+L++VD T + + A + A V K++ + + KV I+SD+G FT+


3S3M_(A)

145

VLVVVDGMTGFTWL---YPTKAPSTSATV-KSLNVLTSIAIPKV--IHSDQGAAFTSSTF

198

YJL113W

452

EEYFISKGIHHILTSTQDHA-ANGRAER

478






E+ +GIH + ST H ++G+ ER


3S3M_(A)

199

AEWAKERGIH-LEFSTPYHPQSSGKVER

225

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3M (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05