Take our Survey

Alignment of ARP1/YHR129C and PDB 1O19 (chain 8) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ARP1/YHR129C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ARP1/YHR129C and PDB protein 1O19 (chain 8)Jump to
Structure
Alignment Details
ARP1 length = 385 aaAlignment Length = 360 aa (93.5%)P-value = 3.2e-91%Identity = 48%Similar = 21
Alignment Position

Sequence Alignment

ARP1

15

VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKL

74






+V DNGSG++KAGF+G++ P+A+ +VG ++ VM+ Q D+++G+ AQ RG+L L


1O19_(8)

8

LVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTL

67

ARP1

75

RYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFET

134






+YPI+HG++ +WD ME IW + L++ EHP L+TEAP+NP NRE+M Q++FET


1O19_(8)

68

KYPIEHGIITNWDDMEKIWHHTFYNELRVAP-EEHPTLLTEAPLNPKANREKMTQIMFET

126

ARP1

135

FDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADIT

194






F+V A+YV+ AVLSLYASGRTTG V+D G+G VPIY+G+ALP ++MR+D+ G D+T


1O19_(8)

127

FNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLT

186

ARP1

195

EQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPD

254






+ L ++ G S +++EREIVR +KEK+CY+A + + E + L +++LPD


1O19_(8)

187

DYLM-KILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMAT-AASSSSLEKSYELPD

244

ARP1

255

GRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTT

314






G+ I +GN+R+R PE LF P IG+ G+ + SI K D+D+RK L ++ ++SGGTT


1O19_(8)

245

GQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTT

304

ARP1

315

TLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE

374






G DRM ++ AL T KIKIIAP ERKY+ WIGGSIL LSTFQ++W K ++ E


1O19_(8)

305

MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDE

364

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1O19 (Chain 8)
Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle
  • PDB_Info
  • Homolog SourceOryctolagus cuniculus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05