Alignment of YGR161C-D and PDB 4E7I (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YGR161C-D. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YGR161C-D and PDB protein 4E7I (chain B)Jump to
Structure
Alignment Details
YGR161C-D length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000160%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YGR161C-D

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


4E7I_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YGR161C-D

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


4E7I_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YGR161C-D

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


4E7I_(B)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YGR161C-D

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


4E7I_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4E7I (Chain B)
Pfv Intasome Freeze-Trapped Prior To 3'-Processing, Mn-Bound Form (Ui- Mn)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05