Take our Survey

Alignment of YGR161C-D and PDB 3OY9 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YGR161C-D. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YGR161C-D and PDB protein 3OY9 (chain A)Jump to
Structure
Alignment Details
YGR161C-D length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000149%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YGR161C-D

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OY9_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YGR161C-D

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OY9_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YGR161C-D

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


3OY9_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YGR161C-D

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OY9_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OY9 (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Manganese At 2.55 Resolution
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05