Alignment of YGR038C-B and PDB 3OYL (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YGR038C-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YGR038C-B and PDB protein 3OYL (chain A)Jump to
Structure
Alignment Details
YGR038C-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 1.2e-05%Identity = 27%Similar = 16
Alignment Position

Sequence Alignment

YGR038C-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P+ Y + D T


3OYL_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YGR038C-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYL_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YGR038C-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++HG ER N + T+L G P W+ + + N+ S


3OYL_(A)

205

RGIHLEFSTPYHPQSHGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YGR038C-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYL_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYL (Chain A)
Crystal Structure Of The Pfv S217h Mutant Intasome Bound To Magnesium And The Insti Mk2048
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05