Alignment of YGR027W-B and PDB 3OYN (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YGR027W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YGR027W-B and PDB protein 3OYN (chain A)Jump to
Structure
Alignment Details
YGR027W-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000529%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YGR027W-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYN_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YGR027W-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYN_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YGR027W-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER + + T+L G P W+ + + N+ S


3OYN_(A)

205

RGIHLEFSTPYHPQSSGKVERKHSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YGR027W-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYN_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYN (Chain A)
Crystal Structure Of The Pfv N224h Mutant Intasome Bound To Magnesium And The Insti Mk2048
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05