Alignment of BNA6/YFR047C and PDB 2B7P (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein BNA6/YFR047C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene BNA6/YFR047C and PDB protein 2B7P (chain B)Jump to
Structure
Alignment Details
BNA6 length = 296 aaAlignment Length = 273 aa (92.2%)P-value = 6.1e-31%Identity = 34%Similar = 15
Alignment Position

Sequence Alignment

BNA6

22

LSEDVPSFDFGGYVVGSDLKE-ANLYCKQDGMLCGVPFAQEVFNQCELQVEWLFKEGSFL

80






L ED+ D V+ D K A + KQ+G+ G +A E+ ++ K+


2B7P_(B)

11

LKEDLGHGDLFERVLEKDFKATAFVRAKQEGVFSGEKYALELLEMTGIECVQTIKDKERF

70

BNA6

81

EPSKNDSGKIVVAKITGPAKNILLAERTALNILSRSSGIATASHKIISLARSTGYKGTIA

140






+P K + +I G +L ERT LN+L SSGIAT + + + S +K +


2B7P_(B)

71

KP------KDALMEIRGDFSMLLKVERTLLNLLQHSSGIATLTSRFVEALNS--HKVRLL

122

BNA6

141

GTRKTTPGLRRLEKYSMLVGGCDTHRYDLSSMVMLKDNHIWATGSITNAVKNARAVCGFA

200






TRKT P LR EKYS+L GG HR L +MLKD H+ + + + +AR F


2B7P_(B)

123

DTRKTRPLLRIFEKYSVLNGGASNHRLGLDDALMLKDTHLRHVKDLKSFLTHARKNLPFT

182

BNA6

201

VKIEVECLSEDEATEAIEAGADVIMLDNFKGDGLKMCAQSLKNKWNGKKHFLLECSGGLN

260






KIE+EC S +EA A+ AGAD++M DN K A + LLE SG ++


2B7P_(B)

183

AKIEIECESFEEAKNAMNAGADIVMCDNLSVLETKEIAAYRDAHY---PFVLLEASGNIS

239

BNA6

261

LDNLEEYLCDDIDIYSTSS-IHQGTPVIDFSLKLA

294






L+++ Y +D S + IHQ T ID +K+A


2B7P_(B)

240

LESINAYAKSGVDAISVGALIHQAT-FIDMHMKMA

273

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2B7P (Chain B)
Crystal Structure Of Quinolinic Acid Phosphoribosyltransferase From Helicobacter Pylori
  • PDB_Info
  • Homolog SourceHelicobacter pylori
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05