Alignment of YER138C and PDB 3OYM (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YER138C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YER138C and PDB protein 3OYM (chain A)Jump to
Structure
Alignment Details
YER138C length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000559%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YER138C

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYM_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YER138C

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYM_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YER138C

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER + + T+L G P W+ + + N+ S


3OYM_(A)

205

RGIHLEFSTPYHPQSSGKVERKHSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YER138C

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYM_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYM (Chain A)
Crystal Structure Of The Pfv N224h Mutant Intasome Bound To Manganese
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05