Alignment of YER138C and PDB 3OYG (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YER138C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YER138C and PDB protein 3OYG (chain B)Jump to
Structure
Alignment Details
YER138C length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000160%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YER138C

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYG_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YER138C

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYG_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YER138C

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


3OYG_(B)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YER138C

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYG_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYG (Chain B)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And The Insti Compound1 (Compoundg)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05