Take our Survey

Alignment of YER138C and PDB 2X74 (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YER138C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YER138C and PDB protein 2X74 (chain C)Jump to
Structure
Alignment Details
YER138C length = 1756 aaAlignment Length = 184 aa (10.5%)P-value = 0.006201%Identity = 24%Similar = 16
Alignment Position

Sequence Alignment

YER138C

653

GSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSIL

712






G L+ +PF D GP+ P Y + D T F W+YP + +


2X74_(C)

1

GPILRPDRPQKPFDKFFXDYIGPLP--PSQGYLYVLVVVDGXTGFTWLYPTKAPSTSATV

58

YER138C

713

DVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAE

772






+ + A VI D+G+ +T+ T ++ ++ GI ++T ++ E


2X74_(C)

59

KSLNVLTSI------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVE

112

YER138C

773

RLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDIST

832






R N T+L G P W+ + + N+ SP K + H L G+D +T


2X74_(C)

113

RKNSDX-KRLLTKLLV-GRPTK-WYDLLPVVQLAXNNTYSPVLKYTP--HQLLFGIDSNT

167

YER138C

833

LLPF

836






PF


2X74_(C)

168

--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X74 (Chain C)
Human Foamy Virus Integrase - Catalytic Core.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05