Alignment of YDR261W-B and PDB 3OYA (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR261W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR261W-B and PDB protein 3OYA (chain B)Jump to
Structure
Alignment Details
YDR261W-B length = 1771 aaAlignment Length = 201 aa (11.3%)P-value = 3.4e-05%Identity = 27%Similar = 13
Alignment Position

Sequence Alignment

YDR261W-B

632

QCPDCLIGKSTKHRHIKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKT

691






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYA_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YDR261W-B

692

RFQWVYPLHDRREESI---LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTN

748






F W+YP + LNV TSI A K VI D+G+ +T+ T ++


3OYA_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YDR261W-B

749

RGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVS

808






RGI ++T ++ G ER N + LL G P W+ + + N+ S


3OYA_(B)

205

RGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLL--VGRPTK-WYDLLPVVQLALNNTYS

261

YDR261W-B

809

PKNDKSARQHAGLAGLDITTILPF

832






P + H L G+D T PF


3OYA_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYA (Chain B)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And Raltegravir At 2.65 Resolution
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05