Alignment of YDR210W-B and PDB 3OS0 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR210W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR210W-B and PDB protein 3OS0 (chain A)Jump to
Structure
Alignment Details
YDR210W-B length = 1771 aaAlignment Length = 201 aa (11.3%)P-value = 2.6e-05%Identity = 27%Similar = 13
Alignment Position

Sequence Alignment

YDR210W-B

632

QCPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKT

691






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OS0_(A)

98

RCQQCLITNASNK--ASGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YDR210W-B

692

RFQWVYPLHDRREESI---LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTN

748






F W+YP + LNV TSI A K VI D+G+ +T+ T ++


3OS0_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YDR210W-B

749

RGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVS

808






RGI ++T ++ G ER N + LL G P W+ + + N+ S


3OS0_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLL--VGRPTK-WYDLLPVVQLALNNTYS

261

YDR210W-B

809

PKNDKSARQHAGLAGLDITTILPF

832






P + H L G+D T PF


3OS0_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OS0 (Chain A)
Pfv Strand Transfer Complex (Stc) At 2.81 A Resolution
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05