Take our Survey

Alignment of YDR098C-B and PDB 3S3O (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR098C-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR098C-B and PDB protein 3S3O (chain B)Jump to
Structure
Alignment Details
YDR098C-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000410%Identity = 26%Similar = 17
Alignment Position

Sequence Alignment

YDR098C-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P+ Y + D T


3S3O_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YDR098C-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3S3O_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YDR098C-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER + + T+L G P W+ + + N+ S


3S3O_(B)

205

RGIHLEFSTPYHPQSSGKVERKHSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YDR098C-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3S3O_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3O (Chain B)
Crystal Structure Of The Prototype Foamy Virus (Pfv) N224h Mutant Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05