Alignment of YDR098C-B and PDB 3OYK (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR098C-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR098C-B and PDB protein 3OYK (chain B)Jump to
Structure
Alignment Details
YDR098C-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 1.2e-05%Identity = 27%Similar = 16
Alignment Position

Sequence Alignment

YDR098C-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P+ Y + D T


3OYK_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YDR098C-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYK_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YDR098C-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++HG ER N + T+L G P W+ + + N+ S


3OYK_(B)

205

RGIHLEFSTPYHPQSHGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YDR098C-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYK_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYK (Chain B)
Crystal Structure Of The Pfv S217h Mutant Intasome Bound To Manganese
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05