Take our Survey

Alignment of YDR098C-B and PDB 2X6S (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR098C-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR098C-B and PDB protein 2X6S (chain A)Jump to
Structure
Alignment Details
YDR098C-B length = 1756 aaAlignment Length = 184 aa (10.5%)P-value = 0.003701%Identity = 24%Similar = 17
Alignment Position

Sequence Alignment

YDR098C-B

653

GSRLKYQNSYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETTKFRWVYPLHDRREDSIL

712






G L+ +PF D GP+ P+ Y + D T F W+YP + +


2X6S_(A)

1

GPILRPDRPQKPFDKFFMDYIGPLP--PSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATV

58

YDR098C-B

713

DVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAE

772






+ + A VI D+G+ +T+ T ++ ++ GI ++T ++ E


2X6S_(A)

59

KSLNVLTSI------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVE

112

YDR098C-B

773

RLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDIST

832






R N + T+L G P W+ + + N+ SP K + H L G+D +T


2X6S_(A)

113

RKNSDM-KRLLTKLLV-GRPTK-WYDLLPVVQLAMNNTYSPVLKYTP--HQLLFGIDSNT

167

YDR098C-B

833

LLPF

836






PF


2X6S_(A)

168

--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X6S (Chain A)
Human Foamy Virus Integrase - Catalytic Core. Magnesium- Bound Structure.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05