Alignment of YDR034C-D and PDB 3L2V (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR034C-D. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR034C-D and PDB protein 3L2V (chain A)Jump to
Structure
Alignment Details
YDR034C-D length = 1771 aaAlignment Length = 201 aa (11.3%)P-value = 2.8e-05%Identity = 27%Similar = 13
Alignment Position

Sequence Alignment

YDR034C-D

632

QCPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKT

691






+C CLI ++ G L+ +PF D GP+ P Y + D T


3L2V_(A)

98

RCQQCLITNASNK--ASGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YDR034C-D

692

RFQWVYPLHDRREESI---LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTN

748






F W+YP + LNV TSI A K VI D+G+ +T+ T ++


3L2V_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YDR034C-D

749

RGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVS

808






RGI ++T ++ G ER N + LL G P W+ + + N+ S


3L2V_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLL--VGRPTK-WYDLLPVVQLALNNTYS

261

YDR034C-D

809

PKNDKSARQHAGLAGLDITTILPF

832






P + H L G+D T PF


3L2V_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3L2V (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Manganese And Mk0518 (Raltegravir)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05