Alignment of YDR034C-D and PDB 2X6S (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YDR034C-D. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YDR034C-D and PDB protein 2X6S (chain B)Jump to
Structure
Alignment Details
YDR034C-D length = 1771 aaAlignment Length = 184 aa (10.4%)P-value = 0.001200%Identity = 27%Similar = 12
Alignment Position

Sequence Alignment

YDR034C-D

649

GSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKTRFQWVYPLHDRREESI-

707






G L+ +PF D GP+ P Y + D T F W+YP +


2X6S_(B)

1

GPILRPDRPQKPFDKFFMDYIGPLP--PSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATV

58

YDR034C-D

708

--LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTNRGITACYTTTADSRAHG

765






LNV TSI A VI D+G+ +T+ T ++ RGI ++T ++


2X6S_(B)

59

KSLNVLTSI---------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGS

109

YDR034C-D

766

VAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVSPKNDKSARQHAGLAGLD

825






ER N + LL G P W+ + + N+ SP + H L G+D


2X6S_(B)

110

KVERKNSDMKRLLTKLL--VGRPTK-WYDLLPVVQLAMNNTYSPVLKYTP--HQLLFGID

164

YDR034C-D

826

ITTILPF

832






T PF


2X6S_(B)

165

SNT--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X6S (Chain B)
Human Foamy Virus Integrase - Catalytic Core. Magnesium- Bound Structure.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05