Take our Survey

Alignment of RSA4/YCR072C and PDB 3OW8 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RSA4/YCR072C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RSA4/YCR072C and PDB protein 3OW8 (chain A)Jump to
Structure
Alignment Details
RSA4 length = 516 aaAlignment Length = 288 aa (55.8%)P-value = 2.3e-19%Identity = 27%Similar = 19
Alignment Position

Sequence Alignment

RSA4

226

RGHSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWD-TVSRV-CQYTMSGHTNSVSC

283






+ H I S++W K + + + S D +K+W R+ Q+++ GH V


3OW8_(A)

29

QAHDDAIWSVAWGTN---KKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVS

85

RSA4

284

VKWGGQ-GLLYSGSHDRTVRVWDINSQGRCINILKSHA--HWVNHLSLSTDYALRIGAFD

340






V + S S D +R+WD+ + G+ I + + W S + Y L G


3OW8_(A)

86

VDISHTLPIAASSSLDAHIRLWDLEN-GKQIKSIDAGPVDAWTLAFSPDSQY-LATGT--

141

RSA4

341

HTGKKPSTPEEAQKK--ALENYEKICKKNGNSEEMMVTASD--DYTMFLWNPLKSTKPIA

396






H GK E+ KK +L+ K S + AS D + +++ + + K +


3OW8_(A)

142

HVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFD-IATGKLLH

200

RSA4

397

RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDC

456






+ GH + + FSPD + +V+AS D IK++D + T GH + V VA+ D


3OW8_(A)

201

TLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDD

260

RSA4

457

RLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW

513






VS S D ++KVWDV TR H+D+V+ V ++ +G ++ S G D+ + ++


3OW8_(A)

261

THFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIY

317

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OW8 (Chain A)
Crystal Structure Of The Wd Repeat-Containing Protein 61
  • PDB_Info
  • Homolog SourceHomo sapiens
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05