Take our Survey

Alignment of YCL019W and PDB 4E7H (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YCL019W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YCL019W and PDB protein 4E7H (chain B)Jump to
Structure
Alignment Details
YCL019W length = 1771 aaAlignment Length = 201 aa (11.3%)P-value = 2.6e-05%Identity = 27%Similar = 13
Alignment Position

Sequence Alignment

YCL019W

632

QCPDCLIGKSTKHRHVKGSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKT

691






+C CLI ++ G L+ +PF D GP+ P Y + D T


4E7H_(B)

98

RCQQCLITNASNK--ASGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YCL019W

692

RFQWVYPLHDRREESI---LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTN

748






F W+YP + LNV TSI A K VI D+G+ +T+ T ++


4E7H_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YCL019W

749

RGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVS

808






RGI ++T ++ G ER N + LL G P W+ + + N+ S


4E7H_(B)

205

RGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLL--VGRPTK-WYDLLPVVQLALNNTYS

261

YCL019W

809

PKNDKSARQHAGLAGLDITTILPF

832






P + H L G+D T PF


4E7H_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4E7H (Chain B)
Pfv Intasome Prior To 3'-Processing, Apo Form (Ui-Apo)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05