Take our Survey

Alignment of ADH5/YBR145W and PDB 1WLY (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ADH5/YBR145W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ADH5/YBR145W and PDB protein 1WLY (chain A)Jump to
Structure
Alignment Details
ADH5 length = 352 aaAlignment Length = 286 aa (81.3%)P-value = 5.3e-07%Identity = 24%Similar = 19
Alignment Position

Sequence Alignment

ADH5

12

AIVFYETDG--KLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHG-DWPFQL-KFPLI

67






A V ++ G +++V V P P ++ + GV D + G P + + P++


1WLY_(A)

4

AAVIHKKGGPDNFVWEEVKVGSPGPGQVRLRNTAIGVNFLDTYHRAGIPHPLVVGEPPIV

63

ADH5

68

GGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYLDGTGFTHDG

127






G E A VV ++G V + VG+ TC+ P L G


1WLY_(A)

64

VGFEAAAVVEEVGPGVTDFTVGERVC------TCL-------------PPL--------G

96

ADH5

128

TFQEYATADAVQAAHIPPNVNLAEV--APILCAGITVYKALKRANVI-PGQWVTISGACG

184






+ + A + +P +++L +V A ++ G+T L + + + PG +V I A G


1WLY_(A)

97

AYSQERLYPAEKLIKVPKDLDLDDVHLAGLMLKGMTAQYLLHQTHKVKPGDYVLIHAAAG

156

ADH5

185

GLGSLAIQYALAMGYRVIGIDGGNAKRKLFEQLGGEIFIDFTEEKDIVGAIIKATNGGSH

244






G+G + + +A +G VIG K + +LG I+++ + D + + T G


1WLY_(A)

157

GMGHIMVPWARHLGATVIGTVSTEEKAETARKLGCHHTINYSTQ-DFAEVVREITGGKGV

215

ADH5

245

GVINVSVSEAAIEASTRYCRPNGTVVLVGMPAHAYCNSDVFNQVVKSISIVGS

297






V+ S+ + ++ S RP G G HA +D +VV+ + + GS


1WLY_(A)

216

DVVYDSIGKDTLQKSLDCLRPRGMCAAYG---HASGVADPI-RVVEDLGVRGS

264

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1WLY (Chain A)
Crystal Structure Of 2-haloacrylate Reductase
  • PDB_Info
  • Homolog SourceBurkholderia sp. WS
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05