Alignment of YBL005W-B and PDB 3S3M (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YBL005W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YBL005W-B and PDB protein 3S3M (chain A)Jump to
Structure
Alignment Details
YBL005W-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000149%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YBL005W-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3S3M_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YBL005W-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3S3M_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YBL005W-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


3S3M_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YBL005W-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3S3M_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3M (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05