Take our Survey

Alignment of YBL005W-B and PDB 2X74 (chain F) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YBL005W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YBL005W-B and PDB protein 2X74 (chain F)Jump to
Structure
Alignment Details
YBL005W-B length = 1756 aaAlignment Length = 184 aa (10.5%)P-value = 0.006201%Identity = 24%Similar = 16
Alignment Position

Sequence Alignment

YBL005W-B

653

GSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKFRWVYPLHDRREDSIL

712






G L+ +PF D GP+ P Y + D T F W+YP + +


2X74_(F)

1

GPILRPDRPQKPFDKFFXDYIGPLP--PSQGYLYVLVVVDGXTGFTWLYPTKAPSTSATV

58

YBL005W-B

713

DVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHGVAE

772






+ + A VI D+G+ +T+ T ++ ++ GI ++T ++ E


2X74_(F)

59

KSLNVLTSI------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVE

112

YBL005W-B

773

RLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLDIST

832






R N T+L G P W+ + + N+ SP K + H L G+D +T


2X74_(F)

113

RKNSDX-KRLLTKLLV-GRPTK-WYDLLPVVQLAXNNTYSPVLKYTP--HQLLFGIDSNT

167

YBL005W-B

833

LLPF

836






PF


2X74_(F)

168

--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X74 (Chain F)
Human Foamy Virus Integrase - Catalytic Core
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05