Take our Survey

Alignment of YAR061W and PDB 2XJR (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YAR061W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YAR061W and PDB protein 2XJR (chain A)Jump to
Structure
Alignment Details
YAR061W length = 68 aaAlignment Length = 45 aa (66.2%)P-value = 1.2e-12%Identity = 67%Similar = 15
Alignment Position

Sequence Alignment

YAR061W

20

VSGSTQACLPVGPRKNGMNVNFYKYSLLDSTTYSYPQYMTSGYAS

64






+SG+T+ACLP G RK+GMN+NFY+YSL DS+TYS YM GYAS


2XJR_(A)

9

MSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYAS

53

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2XJR (Chain A)
X-Ray Structure Of The N-Terminal Domain Of The Flocculin Flo5 From Saccharomyces Cerevisiae In Complex With Calcium And Man5(D2-D3)
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae S288c
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05