Take our Survey

Alignment of YAR009C and PDB 4E7J (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YAR009C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YAR009C and PDB protein 4E7J (chain A)Jump to
Structure
Alignment Details
YAR009C length = 1197 aaAlignment Length = 201 aa (16.8%)P-value = 0.000439%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YAR009C

77

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

136






+C CLI ++ G L+ +PF D GP+ P Y + D T


4E7J_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YAR009C

137

KLRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

193






W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


4E7J_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YAR009C

194

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

253






GI ++T ++ G ER N + T+L G P W+ + + N+ S


4E7J_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YAR009C

254

PKSKKSARQHAGLAGLDISTLLPF

277






P K + H L G+D +T PF


4E7J_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4E7J (Chain A)
Pfv Integrase Target Capture Complex, Apo Form (Tcc-Apo), At 3.15 A Resolution
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05