Alignment of YAR009C and PDB 3S3O (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YAR009C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YAR009C and PDB protein 3S3O (chain A)Jump to
Structure
Alignment Details
YAR009C length = 1197 aaAlignment Length = 201 aa (16.8%)P-value = 0.001599%Identity = 25%Similar = 17
Alignment Position

Sequence Alignment

YAR009C

77

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

136






+C CLI ++ G L+ +PF D GP+ P Y + D T


3S3O_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YAR009C

137

KLRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

193






W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3S3O_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YAR009C

194

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

253






GI ++T ++ G ER + + T+L G P W+ + + N+ S


3S3O_(A)

205

RGIHLEFSTPYHPQSSGKVERKHSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YAR009C

254

PKSKKSARQHAGLAGLDISTLLPF

277






P K + H L G+D +T PF


3S3O_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3O (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) N224h Mutant Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05