Alignment of YAR009C and PDB 3DLR (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YAR009C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YAR009C and PDB protein 3DLR (chain A)Jump to
Structure
Alignment Details
YAR009C length = 1197 aaAlignment Length = 184 aa (15.4%)P-value = 0.001999%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YAR009C

94

GSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTKLRWVYPLHDRREDSI-

152






G L+ +PF D GP+ P Y + D T W+YP +


3DLR_(A)

5

GPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGXTGFTWLYPTKAPSTSATV

62

YAR009C

153

--LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGITPCYTTTADSRAHG

210






L+V T+I A K VI D+G+ +T+ T ++ ++ GI ++T ++ G


3DLR_(A)

63

KSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSG

113

YAR009C

211

VAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLASPKSKKSARQHAGLAGLD

270






ER N + T+L G P W+ + + N+ SP K + H L G+D


3DLR_(A)

114

KVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYSPVLKYTP--HQLLFGID

168

YAR009C

271

ISTLLPF

277






+T PF


3DLR_(A)

169

SNT--PF

173

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3DLR (Chain A)
Crystal Structure Of The Catalytic Core Domain From Pfv Integrase
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05