Alignment of FLP1/R0010W and PDB 1P4E (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein FLP1/R0010W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene FLP1/R0010W and PDB protein 1P4E (chain A)Jump to
Structure
Alignment Details
FLP1 length = 424 aaAlignment Length = 421 aa (99.3%)P-value = 2.5e-221%Identity = 99%Similar = 0
Alignment Position

Sequence Alignment

FLP1

3

QFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYNT

62






QF ILCKTPPKVLVRQFVERFERPSGEKIA CAAELTYLCWMITHNGTAIKRATFMSYNT


1P4E_(A)

2

QFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTAIKRATFMSYNT

61

FLP1

63

IISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIVSS

122






IISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPY GQKHQSDITDIVSS


1P4E_(A)

62

IISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYNGQKHQSDITDIVSS

121

FLP1

123

LQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFLF

182






LQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFLF


1P4E_(A)

122

LQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFLF

181

FLP1

183

LATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDPL

242






LATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDPL


1P4E_(A)

182

LATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDPL

241

FLP1

243

VYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGP

302






VYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPY IFAIKNGP


1P4E_(A)

242

VYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGP

301

FLP1

303

KSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYY

362






KSHIGRHLMTSFLSMKGLTELTNVVGN+SDKRASAVARTTYTHQITAIPDHYFALVSRYY


1P4E_(A)

302

KSHIGRHLMTSFLSMKGLTELTNVVGNFSDKRASAVARTTYTHQITAIPDHYFALVSRYY

361

FLP1

363

AYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRR

422






AYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRR


1P4E_(A)

362

AYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRR

421

FLP1

423

I

423






I


1P4E_(A)

422

I

422

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1P4E (Chain A)
Flpe W330f Mutant-Dna Holliday Junction Complex
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05