Alignment of FLP1/R0010W and PDB 1M6X (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein FLP1/R0010W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene FLP1/R0010W and PDB protein 1M6X (chain C)Jump to
Structure
Alignment Details
FLP1 length = 424 aaAlignment Length = 423 aa (99.8%)P-value = 5.8e-222%Identity = 99%Similar = 0
Alignment Position

Sequence Alignment

FLP1

1

MPQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSY

60






M QF ILCKTPPKVLVRQFVERFERPSGEKIA CAAELTYLCWMITHNGTAIKRATFMSY


1M6X_(C)

1

MSQFDILCKTPPKVLVRQFVERFERPSGEKIASCAAELTYLCWMITHNGTAIKRATFMSY

60

FLP1

61

NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIV

120






NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPY GQKHQSDITDIV


1M6X_(C)

61

NTIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYNGQKHQSDITDIV

120

FLP1

121

SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF

180






SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF


1M6X_(C)

121

SSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQF

180

FLP1

181

LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID

240






LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID


1M6X_(C)

181

LFLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRID

240

FLP1

241

PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKN

300






PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPY IFAIKN


1M6X_(C)

241

PLVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKN

300

FLP1

301

GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSR

360






GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTT THQITAIPDHYFALVSR


1M6X_(C)

301

GPKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTXTHQITAIPDHYFALVSR

360

FLP1

361

YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN

420






YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN


1M6X_(C)

361

YYAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYIN

420

FLP1

421

RRI

423






RRI


1M6X_(C)

421

RRI

423

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1M6X (Chain C)
Flpe-Holliday Junction Complex
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05