Alignment of FLP1/R0010W and PDB 1FLO (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein FLP1/R0010W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene FLP1/R0010W and PDB protein 1FLO (chain D)Jump to
Structure
Alignment Details
FLP1 length = 424 aaAlignment Length = 422 aa (99.5%)P-value = 2.8e-225%Identity = 100%Similar = 0
Alignment Position

Sequence Alignment

FLP1

2

PQFGILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYN

61






PQF ILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYN


1FLO_(D)

1

PQFDILCKTPPKVLVRQFVERFERPSGEKIALCAAELTYLCWMITHNGTAIKRATFMSYN

60

FLP1

62

TIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIVS

121






TIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIVS


1FLO_(D)

61

TIISNSLSFDIVNKSLQFKYKTQKATILEASLKKLIPAWEFTIIPYYGQKHQSDITDIVS

120

FLP1

122

SLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFL

181






SLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFL


1FLO_(D)

121

SLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTSRFTKTKTLYQFL

180

FLP1

182

FLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDP

241






FLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDP


1FLO_(D)

181

FLATFINCGRFSDIKNVDPKSFKLVQNKYLGVIIQCLVTETKTSVSRHIYFFSARGRIDP

240

FLP1

242

LVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNG

301






LVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNG


1FLO_(D)

241

LVYLDEFLRNSEPVLKRVNRTGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNG

300

FLP1

302

PKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRY

361






PKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRY


1FLO_(D)

301

PKSHIGRHLMTSFLSMKGLTELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRY

360

FLP1

362

YAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINR

421






YAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINR


1FLO_(D)

361

YAYDPISKEMIALKDETNPIEEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINR

420

FLP1

422

RI

423






RI


1FLO_(D)

421

RI

422

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1FLO (Chain D)
Flp Recombinase-Holliday Junction Complex I
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05