Sequence for a region of YOR331C

Send questions or suggestions to SGD

BLAST search | FASTA search


Protein translation of the coding sequence.

Other Formats Available: GCG

>YOR331C  Chr 15   reverse complement
MSSFIDSIKSTSLSRALTIALGSNNFKSASTINDCKMGLYSSRLLAIPDNFSLVSSNIPS
SDCSRAERTFNLILFAIVDLVICCESMAFFNLLLKLPSMLLVSFLTMLVFSISYSWSAFN
WISFAFSSASFLMKACILFNSSFTWFGVKAVIAEDMLYRMVRGLFCASFVKQLQTTFLAT
AIVLC*

Return to SGD
Send a Message to the SGD Curators

SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.