Fungal Sequence Alignment

Help

This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al. We will soon include sequences from other fungal genomes from a variety of sources.

ClustalW Protein Alignment and Sequence for YJL114W and Homologs

Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)

Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_YJL114W


1


MATPVRGETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVRQ


50
MIT_Sbay_c334_12614


1


MAAPVRDDTRNVIDDNISTQVQSKVKLQEYSIDTSIEIDQQDLEILRTLL


50
Symbols






**:***.:**********:::***** :: :*. .: : .:: :.



SGD_Scer_YJL114W


51


YQRNLNRFKTILNGLKAEEEKLSEADDIQMLAEKLLKLGETIDKVENRIV


100
MIT_Sbay_c334_12614


51


QKLIIKRNEIMNN---------HTQEDESLVTDKLVEVIGKIDKVQNNIH


91
Symbols






: ::* : : * :* .::::**::: .****:*.*



SGD_Scer_YJL114W


101


DLVEKIQLLETNENNNILHEHIDATGTYYLFDTLTSTNKRFYPKDCVFDY


150
MIT_Sbay_c334_12614


92


TLKKRLETIDFEEG------------------------------------


105
Symbols






* :::: :: :*.



SGD_Scer_YJL114W


151


RTNNVENIPILLNNFKKFIKKYQFDDVFENDIIEIDPRENEILCKIIKEG


200
MIT_Sbay_c334_12614






--------------------------------------------------



Symbols










SGD_Scer_YJL114W


201


LGESLDIMNTNTTDIFRIIDGLKKQI


226
MIT_Sbay_c334_12614






--------------------------



Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.


Protein Sequence for SGD_Scer_YJL114W:

SGD_Scer_YJL114W  Length: 227  Wed Feb  2 01:21:08 2011  Type: P  Check: 8962  ..

       1  MATPVRGETR NVIDDNISAR IQSKVKTNDT VRQTPSSLRK VSIKDEQVRQ

      51  YQRNLNRFKT ILNGLKAEEE KLSEADDIQM LAEKLLKLGE TIDKVENRIV

     101  DLVEKIQLLE TNENNNILHE HIDATGTYYL FDTLTSTNKR FYPKDCVFDY

     151  RTNNVENIPI LLNNFKKFIK KYQFDDVFEN DIIEIDPREN EILCKIIKEG

     201  LGESLDIMNT NTTDIFRIID GLKKQI*

Protein Sequence for MIT_Sbay_c334_12614:

MIT_Sbay_c334_12614  Length: 105  Wed Feb  2 01:21:08 2011  Type: P  Check: 5310  ..

       1  MAAPVRDDTR NVIDDNISTQ VQSKVKLQEY SIDTSIEIDQ QDLEILRTLL

      51  QKLIIKRNEI MNNHTQEDES LVTDKLVEVI GKIDKVQNNI HTLKKRLETI

     101  DFEEG